PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2506s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 239aa    MW: 26054 Da    PI: 6.2316
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2506s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.31.1e-30101154155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Araha.2506s0007.1.p 101 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 154
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-2098158IPR009057Homeodomain-like
PROSITE profilePS5129411.05998157IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-31100159IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24102154IPR006447Myb domain, plants
PfamPF002497.8E-8104153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MREDDSDWFA RWEEELPSPE ELMPISQSLI SPDLALAFDI RSPNHGNGNS NQPHHHQTTP  60
PTPSQLQLPS SQANSSAEFA ADSADLGSGA AGDEPARTLK RPRLVWTPQL HKRFVDAVAH  120
LGIKNAVPKT IMQLMSVDGL TRENVASHLQ KYRLYLKRMQ GLSSGGGAGS DPATDRLFAS  180
SPFDPSFLAV RQTQQQQPIH RMSTPSLHSP VGNYVEDLES ANANGGRTVL TLFPTRDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-21100159463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATAC0117080.0AC011708.8 Arabidopsis thaliana chromosome III BAC T7M13 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298091.11e-118hypothetical protein CARUB_v10014134mg
SwissprotQ9SNB41e-51PCL1_ARATH; Transcription factor LUX
TrEMBLR0HMQ61e-118R0HMQ6_9BRAS; Uncharacterized protein
STRINGscaffold_301238.11e-111(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.15e-73G2-like family protein